powered by:
Protein Alignment unpg and hoxb6
DIOPT Version :9
Sequence 1: | NP_477146.1 |
Gene: | unpg / 35942 |
FlyBaseID: | FBgn0015561 |
Length: | 485 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002938066.1 |
Gene: | hoxb6 / 100124320 |
XenbaseID: | XB-GENE-1006005 |
Length: | 223 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 37/73 - (50%) |
Similarity: | 45/73 - (61%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 NGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375
|.|......||.|..:|..|.||||:|||..:||:...|.:||.||.|:|.|:||||||||.|||
Frog 137 NSSVFGPSGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHSLCLTERQIKIWFQNRRMKWK 201
Fly 376 RVKAGLTS 383
:....|.|
Frog 202 KESKLLNS 209
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.