DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb5

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001094494.1 Gene:hoxb5 / 100113366 XenbaseID:XB-GENE-1005991 Length:258 Species:Xenopus tropicalis


Alignment Length:232 Identity:72/232 - (31%)
Similarity:94/232 - (40%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 SYRRLAELMNQD-YVHSLS-VHARLQHMAAAGRMHEDQANPGM---------AQLQEPTP-PQAH 225
            |||..|..|... |.::.: :...:...||:...:.|.|.||.         ..|..|.| |.|.
 Frog    35 SYREAAGSMQPSAYGYNYNGMDLSVSRAAASSSHYGDSAFPGQESRFRANQSCPLATPDPLPCAK 99

  Fly   226 SSPAKSGSHSPMEPALDVGMDEDF----ECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE 286
            |   .....||.:||...|....|    |.|..|.::.|.|  ||:                   
 Frog   100 S---HKDELSPTDPATSAGSSAQFTEVEETSASSETEESST--PRS------------------- 140

  Fly   287 DCSDDEGAQSRHEGGGMGGKDSQG------------NGSSSNSKSRRRRTAFTSEQLLELEREFH 339
              |....|...:...|..|.|.|.            |...:....:|.|||:|..|.||||:|||
 Frog   141 --SAPPRALQENSSPGAAGTDGQNPQIFPWMRKLHINHDMTGPDGKRARTAYTRYQTLELEKEFH 203

  Fly   340 AKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            ..:||:...|.:||.:|.|||.|:||||||||.|||:
 Frog   204 FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
hoxb5NP_001094494.1 Homeobox 187..240 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.