DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and shox2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001093694.1 Gene:shox2 / 100101703 XenbaseID:XB-GENE-480993 Length:311 Species:Xenopus tropicalis


Alignment Length:175 Identity:52/175 - (29%)
Similarity:67/175 - (38%) Gaps:47/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 EDCSDDEGAQSRHEGGGMGGKDSQGNGSS------------------------------------ 314
            |...:|..|.:|..|||.||....|...|                                    
 Frog    43 EGAREDGLAGNRCIGGGGGGGGGGGGARSPVLELDLSVERIRESGSPKLTEVSPEIKERKEELKQ 107

  Fly   315 --------SNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRR 371
                    :..|.||.||.||.|||.||||.|....|.....|.:::..|.|||.:|::||||||
 Frog   108 QALEEEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRR 172

  Fly   372 AKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQ 416
            ||.::.:..|....|...|:......|.|   :||..|:|...||
 Frog   173 AKCRKQENQLHKGVLIGAGSQFEACRVAP---YVNVGALRMPFQQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
shox2NP_001093694.1 Homeobox 123..177 CDD:365835 27/53 (51%)
OAR 292..307 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.