DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and nkx3-1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_012814889.1 Gene:nkx3-1 / 100038192 XenbaseID:XB-GENE-479027 Length:211 Species:Xenopus tropicalis


Alignment Length:217 Identity:64/217 - (29%)
Similarity:89/217 - (41%) Gaps:81/217 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 MNQDYVHSLSVHAR----------LQHMAAAGRMHEDQANPGMAQLQE-----------PTPPQA 224
            |:|.....||:.|:          |.|: ..||..:...:|...|.|:           |...|:
 Frog     1 MSQQGTEDLSLPAKPLKSFLIQDILSHI-GPGRKEKSLDSPKTDQDQDSSLGGKKENCTPEKQQS 64

  Fly   225 HSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCS 289
            .|.||:. .||.||       ||:.|.      |.:..:||      ::|               
 Frog    65 SSQPAEM-HHSQME-------DENVEL------DQAQPISP------VEK--------------- 94

  Fly   290 DDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIAT 354
                                    ....:.:|.|.||:..|::||||:|.::||||..||:|:|.
 Frog    95 ------------------------KLKLQQKRSRAAFSHSQVIELERKFSSQKYLSAPERAQLAK 135

  Fly   355 SLKLSEVQVKIWFQNRRAKWKR 376
            ||||:|.||||||||||.|.||
 Frog   136 SLKLTETQVKIWFQNRRYKTKR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
nkx3-1XP_012814889.1 Homeobox 103..157 CDD:365835 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.