DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxd10

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_031749087.1 Gene:hoxd10 / 100038085 XenbaseID:XB-GENE-485204 Length:274 Species:Xenopus tropicalis


Alignment Length:263 Identity:61/263 - (23%)
Similarity:104/263 - (39%) Gaps:59/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 FLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGR------------------ 203
            :||  ..|..|:|:|.|.:......:.....:||..:.|.|:.....                  
 Frog    15 YLP--GCAYYVSPSDFSSKSSFFSQSSSCPMTLSYSSNLTHVQPVREVAFREYGLERTKWQYRGT 77

  Fly   204 ----------MHEDQANPGMAQ----------LQEPTPPQA----HSSPAKSGSHSPMEPALDVG 244
                      ||.|...|...:          .....||.:    :||..::|       .|..|
 Frog    78 YPSYYPSEEVMHRDLIQPANRRSDMLFKSDSVCNHHGPPSSQSNFYSSVGRNG-------ILPQG 135

  Fly   245 MDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQ 309
            .|:.::.|.:....:.:...|    .:.|.....|.|.:.|   :.|:...:....|...|:..:
 Frog   136 FDQFYDSSQNQGYQVGMEEQP----AKSDPKATNAPTKAPS---TQDKKVTNDSSPGTPSGEAEK 193

  Fly   310 GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW 374
            .| ||::.:.|::|..::..|:.||||||....|::..:|.|::..|.|::.||||||||||.|.
 Frog   194 SN-SSASQRLRKKRCPYSKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKE 257

  Fly   375 KRV 377
            |::
 Frog   258 KKL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
hoxd10XP_031749087.1 DUF3528 41..163 CDD:403310 19/132 (14%)
Homeobox 205..259 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.