DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unpg and DUXB

DIOPT Version :9

Sequence 1:	NP_477146.1	Gene:	unpg / 35942	FlyBaseID:	FBgn0015561	Length:	485	Species:	Drosophila melanogaster
Sequence 2:	NP_001338236.1	Gene:	DUXB / 100033411	HGNCID:	33345	Length:	345	Species:	Homo sapiens

Alignment Length:	125	Identity:	31/125 - (24%)
Similarity:	53/125 - (42%)	Gaps:	7/125 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   321 RRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTS-- 383
            |.|..:...|...|:..|....:.....|.|:|..:.:.|..:::||:|.|.|.:::.....|
Human    17 RNRIQYNQSQKDILQSWFQHDPFPDKAAREQLAKEIGVPESNIQVWFKNYRVKQRKLDYKCFSEK 81

  Fly   384 -HGLGRNGTTSGTKIVVPIPVHVNR-FAVRSQHQQLEKMCLSGPKPDL--RKKLSAEAIG 439
             ...|.:.:...|:..:|......: |...:|..:|.:.....|.||:  |||| ||..|
Human    82 DQTQGHDQSQHLTQEYLPKEARQKQTFITWTQKNRLVQAFERNPFPDIATRKKL-AEQTG 140

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unpg	NP_477146.1	Homeobox	324..375	CDD:278475	12/50 (24%)
DUXB	NP_001338236.1	homeodomain	16..72	CDD:238039	14/54 (26%)
		homeodomain	103..161	CDD:238039	13/39 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	282..314
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910