DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and YEA6

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_010910.1 Gene:YEA6 / 856712 SGDID:S000000732 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:104/299 - (34%)
Similarity:153/299 - (51%) Gaps:27/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VAGVSG---GVVSTLILHPLDLIKIRFAVN--DGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGV 86
            ||.:||   |.:|.:::.|.|:.|.|....  ...|.....|:|....|.|||:.||..|||||:
Yeast    40 VAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGL 104

  Fly    87 TPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTM-NMLAAAESGILTLLLTNPIWVVKTRL 150
            .|.|.|...:..:||..|:..:.:   .....|..|.: |..:|..:|.::.:.|||||||||||
Yeast   105 QPTVLGYIPTLMIYFSVYDFCRKY---SVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRL 166

  Fly   151 CLQCDAAS-SAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGAIQFMTYEELK--NAYNEY 212
            .||..... |..|:|.|....:|.::||.:.||.|.||.:||:.:.||||..||.||  ..|:|.
Yeast   167 MLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQFPLYENLKIRFGYSES 231

  Fly   213 RKLPIDTKLATTEYLAFAA-VSKLIAAAATYPYQVVRARLQ---------DHHHRYNGTWDCIKQ 267
            ..:..|...:..:.|..|: :||::|:..|||::::|.|:|         ..|     ....||.
Yeast   232 TDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRH-----LLPLIKI 291

  Fly   268 TWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFL 306
            |:|.||:.|||.|...:|.|.|||.:||.:.:|....:|
Yeast   292 TYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 96/278 (35%)
Mito_carr 23..115 CDD:278578 30/92 (33%)
Mito_carr 119..213 CDD:278578 42/97 (43%)
Mito_carr 220..307 CDD:278578 31/97 (32%)
YEA6NP_010910.1 Mito_carr 43..128 CDD:395101 28/84 (33%)
Mito_carr 135..227 CDD:395101 39/91 (43%)
Mito_carr 240..334 CDD:395101 31/96 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0764
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoFinder 1 1.000 - - FOG0002021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100767
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1155
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.