DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and YIA6

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_012260.1 Gene:YIA6 / 854811 SGDID:S000001268 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:114/333 - (34%)
Similarity:168/333 - (50%) Gaps:35/333 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNPIKAQS-------TGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTA 58
            :.|||..|       |...||:...:..:...| :|...|.:|.:.:.|||:.|.|......:|.
Yeast    50 IEPIKMNSSTESIIGTTLRKKWVPLSSTQITAL-SGAFAGFLSGVAVCPLDVAKTRLQAQGLQTR 113

  Fly    59 -TVPQYRGLSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGP 122
             ..|.|||:....:||.|.||.||||||:.|.|.|...:|.:||..|...|.|..|      :.|
Yeast   114 FENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHG------IFP 172

  Fly   123 TMNML----AAAESGILTLLLTNPIWVVKTRLCLQCDAAS-SAEYRGMIHALGQIYKEEGIRGLY 182
            ..:.:    ||..:|..:..||||||||||||.||.:... ...|:|...|..:::.:||.:.||
Yeast   173 QFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALY 237

  Fly   183 RGFVPGMLGVSHGAIQFMTYEELKNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVV 247
            .|.||.:||:.|.||.|..||:||..::.|.:......:.....:..::|||:||:|.|||::::
Yeast   238 AGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEIL 302

  Fly   248 RARLQ------DHHHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFL 306
            |.|:|      |...|  ..:..||.|:..||.:|||.|...:|.|.:||..:|.:.:|   :| 
Yeast   303 RTRMQLKSDIPDSIQR--RLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE---YF- 361

  Fly   307 LARRKRIE 314
               |.|:|
Yeast   362 ---RNRLE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 100/285 (35%)
Mito_carr 23..115 CDD:278578 35/92 (38%)
Mito_carr 119..213 CDD:278578 38/98 (39%)
Mito_carr 220..307 CDD:278578 30/92 (33%)
YIA6NP_012260.1 Mito_carr 75..171 CDD:395101 35/102 (34%)
Mito_carr 176..268 CDD:395101 37/91 (41%)
Mito_carr 274..365 CDD:395101 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0764
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoFinder 1 1.000 - - FOG0002021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100767
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1725
SonicParanoid 1 1.000 - - X1155
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.