DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and aralar1

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:316 Identity:92/316 - (29%)
Similarity:140/316 - (44%) Gaps:44/316 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKAQSTGSPKKFNVFAHV---KYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQ--Y 63
            |||  ..||...:.|..|   .|...:...:|.|.:| :::|:||:|.|.. |....:.:.:  |
  Fly   336 IKA--VESPADRSAFIQVLESSYRFTLGSFAGAVGAT-VVYPIDLVKTRMQ-NQRAGSYIGEVAY 396

  Fly    64 RGLSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFI--QGGNTTMPLGPT-MN 125
            |.....|..:.|.|||.|||:|:.|.:.|......:.....:.::..:  :.||.     || ..
  Fly   397 RNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNI-----PTWAE 456

  Fly   126 MLAAAESGILTLLLTNPIWVVKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGML 190
            :||...:|...::.|||:.:||.||.:..:.||.::.|..     .:.:|.|:.|||:|....:|
  Fly   457 VLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASGSKIRAW-----SVVRELGLFGLYKGARACLL 516

  Fly   191 -GVSHGAIQFMTYEEL------KNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVR 248
             .|...||.|.||...      |:.||....|           ||..|::.:.||:...|..|::
  Fly   517 RDVPFSAIYFPTYAHTKAMMADKDGYNHPLTL-----------LAAGAIAGVPAASLVTPADVIK 570

  Fly   249 ARLQ----DHHHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYE 300
            .|||    .....|.|.||..|:....||.|.|:||..|.:.|..|...||.:.||
  Fly   571 TRLQVVARSGQTTYTGVWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYE 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 81/292 (28%)
Mito_carr 23..115 CDD:278578 23/95 (24%)
Mito_carr 119..213 CDD:278578 31/101 (31%)
Mito_carr 220..307 CDD:278578 28/85 (33%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 24/99 (24%)
PTZ00169 358..631 CDD:240302 84/292 (29%)
Mito_carr 449..539 CDD:278578 30/99 (30%)
Mito_carr 544..633 CDD:278578 29/94 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.