DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and CG7943

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:301 Identity:71/301 - (23%)
Similarity:124/301 - (41%) Gaps:32/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQE 77
            |:|  |...::|....|.....|:..:.:|:..:..|..::.     ||    ::|||..: |.|
  Fly    46 KRF--FGSFQWEEFACGCGAAFVNIAVTYPIYKMIFRQMLHG-----VP----ITSAFAQL-RHE 98

  Fly    78 GFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNP 142
            |...||:|:.|.:.....|..:.|..::..:.::.........|  ..:|||..:|....:|. |
  Fly    99 GLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYG--AKVLAAVVAGSAESILL-P 160

  Fly   143 IWVVKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGML--GVSHGAIQFMTYEEL 205
            ...|:|   |..|:.....:....:|...:....|.|.||||..|...  |:|: |:.|:..||.
  Fly   161 FERVQT---LLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSN-ALFFVLREEA 221

  Fly   206 KNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAAT--YPYQVVRARLQ-DHHHRYNGTWDCIKQ 267
            .      .:||....::|.....|.|.:.:.|:.:|  ||..|::..|| :...|..|:|...|:
  Fly   222 S------VRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQACKR 280

  Fly   268 TW--RFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFL 306
            .:  |......||:|...:..|...:..:....|||:...:
  Fly   281 IYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKKLM 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 67/280 (24%)
Mito_carr 23..115 CDD:278578 19/91 (21%)
Mito_carr 119..213 CDD:278578 25/95 (26%)
Mito_carr 220..307 CDD:278578 22/92 (24%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 19/91 (21%)
Mito_carr 141..229 CDD:278578 27/100 (27%)
Mito_carr 235..322 CDD:278578 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.