DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and CG1907

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:318 Identity:76/318 - (23%)
Similarity:136/318 - (42%) Gaps:30/318 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFR 75
            :|||......:|:  |..|:| |:.:|:::.||||:|.|..:: |..:...:||.......||..
  Fly     9 APKKAVATNAIKF--LFGGLS-GMGATMVVQPLDLVKTRMQIS-GAGSGKKEYRSSLHCIQTIVS 69

  Fly    76 QEGFRGLYKGVTPNVWGSGS----SWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILT 136
            :||...||:|:...:....:    ..|:|....:..:...|...     |.|.:|.....:|...
  Fly    70 KEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSP-----GITDSMAMGTIAGACG 129

  Fly   137 LLLTNPIWVVKTRLCL--QCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVP--GMLGVSHGAI 197
            ..:..|..|...|:..  :...|....|..:.:||.:|.:|||:..|:||.:|  |...|.: ..
  Fly   130 AFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVN-MT 193

  Fly   198 QFMTYEELKNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQ-----DHHHR 257
            |..:|.:.|   ..:|..|:..:.....:...:.:|.|:....:.|..:.:.|:|     |....
  Fly   194 QLASYSQFK---TYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPE 255

  Fly   258 YNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSH----FLLARRK 311
            |.||.|.:.:..|.||....:||......|:.|..::||::.|.::.    ::|...|
  Fly   256 YRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLGSNK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 68/286 (24%)
Mito_carr 23..115 CDD:278578 24/95 (25%)
Mito_carr 119..213 CDD:278578 24/97 (25%)
Mito_carr 220..307 CDD:278578 20/95 (21%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 24/96 (25%)
Mito_carr 118..207 CDD:278578 22/92 (24%)
Mito_carr 219..307 CDD:278578 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.