DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and CG4743

DIOPT Version :10

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:61 Identity:15/61 - (24%)
Similarity:23/61 - (37%) Gaps:18/61 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 KEEREEKREVAKV--KKYNKRLKELR-MDVRSSLYDKTVQA---------------HVHSY 251
            |:::..||:|..|  ...::....|. .|...|::|..|||               |.|.|
  Fly    90 KDDKVRKRDVINVAHNTIHRGAPPLEPCDEYWSMWDTIVQAELFIARVLKFDMTIVHPHKY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 Mito_carr 23..115 CDD:395101
Mito_carr 119..213 CDD:395101 1/3 (33%)
Mito_carr 220..307 CDD:395101 11/50 (22%)
CG4743NP_651415.1 PTZ00168 25..281 CDD:185494 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.