DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and CG4743

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:289 Identity:79/289 - (27%)
Similarity:119/289 - (41%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKAQSTGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSS 68
            ||.|...:..||       :..||||...|:|..:.|.|:|.:|.|.....|             
  Fly    16 IKMQEPVNKLKF-------FHALVAGGVAGMVVDIALFPIDTVKTRLQSELG------------- 60

  Fly    69 AFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESG 133
                .:|..||||:|||:.|...||..:..|:|..|...|.|:.....|.. .|.::|.||:.:.
  Fly    61 ----FWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKD-SPYVHMAAASAAE 120

  Fly   134 ILTLLLTNPIWVVKTR-LCLQCDAASSAEYRGMIHALGQIYKEEGI-RGLYRGFVPG---MLGVS 193
            :|..|:..|:.:.|.| ..||.:..|.      :..|.:.|:.||: |||||||  |   |..:.
  Fly   121 VLACLIRVPVEIAKQRSQTLQGNKQSG------LQILLRAYRTEGLKRGLYRGF--GSTIMREIP 177

  Fly   194 HGAIQFMTYEELKNAYNE---YRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARL---- 251
            ...|||..:|..|..:..   :...|....|.       .||:..|:|..|.|..||:.|:    
  Fly   178 FSLIQFPLWEYFKLQWTPLTGFDSTPFSVALC-------GAVAGGISAGLTTPLDVVKTRIMLAE 235

  Fly   252 QDHHHRYNGTWDCIKQTWRFEGYRGFYKG 280
            ::..:|.......:...:...|:.|.:.|
  Fly   236 RESLNRRRSARRILHGIYLERGFSGLFAG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 76/280 (27%)
Mito_carr 23..115 CDD:278578 28/91 (31%)
Mito_carr 119..213 CDD:278578 30/101 (30%)
Mito_carr 220..307 CDD:278578 14/65 (22%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 29/99 (29%)
PTZ00168 25..281 CDD:185494 76/280 (27%)
Mito_carr 199..291 CDD:278578 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.