DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and CG5805

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:307 Identity:75/307 - (24%)
Similarity:119/307 - (38%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTPNVWGSG---SSWGLYF 101
            |.||.:||.:..|......    |:|:......|:|.||..|||:|    .|.|.   .|...|.
  Fly    57 LFPLTVIKTQLQVQHKSDV----YKGMVDCAMKIYRSEGVPGLYRG----FWISSVQIVSGVFYI 113

  Fly   102 MFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLL---LTNPIWVVKTRLCLQCDAASSAEYR 163
            ..|..::..:.      .||....|.|.|..|..:|:   :..|..|: ::..:....::.|..:
  Fly   114 STYEGVRHVLN------DLGAGHRMKALAGGGCASLVGQTIIVPFDVI-SQHAMVLGMSAHAGSK 171

  Fly   164 GMIHALG------------------QIYKEEGIRGLYRGFVPGMLG-VSHGAIQFMTY----EEL 205
            |.|:.||                  :|.:.:|.||.|||:...::. |.:.|:.:..|    :||
  Fly   172 GDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDEL 236

  Fly   206 KNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQDHHHRYNGTWDCIKQTWR 270
                  :|..|:.......:.:| .::........|.|..:||||||  .||.:......::.|:
  Fly   237 ------FRICPVWVSHLFIQCVA-GSLGGFTTTILTNPLDIVRARLQ--VHRLDSMSVAFRELWQ 292

  Fly   271 FEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFLLARRKRIETKE 317
            .|....|:|||.|.|.:.........|.||.:        |||...|
  Fly   293 EEKLNCFFKGLSARLVQSAAFSFSIILGYETI--------KRIAVDE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 68/275 (25%)
Mito_carr 23..115 CDD:278578 21/77 (27%)
Mito_carr 119..213 CDD:278578 26/119 (22%)
Mito_carr 220..307 CDD:278578 22/86 (26%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 21/81 (26%)
Mito_carr 132..238 CDD:395101 24/112 (21%)
Mito_carr 245..327 CDD:395101 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.