DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and DPCoAC

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:305 Identity:84/305 - (27%)
Similarity:139/305 - (45%) Gaps:32/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LVAGVSGGVVSTLILHPLDLIKIRFAV-NDGRTATVP-QYRGLSSAFTTIFRQEGFRGLYKGVTP 88
            |::|.:.|.::..::.|||..||.|.: ||     || .:|.........:..||...|::|.:.
  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRND-----VPFSFRASLRYLQNTYANEGVLALWRGNSA 135

  Fly    89 NVWGSGSSWGLYFMFYNTIKTFI----QGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTR 149
            .:........:.|..:...:..:    .|.||     .....||.:.:||.:..||.|:.:.:.|
  Fly   136 TMARIVPYAAIQFTAHEQWRRILHVDKDGTNT-----KGRRFLAGSLAGITSQSLTYPLDLARAR 195

  Fly   150 LCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGV-SHGAIQFMTYEELKNAYNEYR 213
            :.: .|..:.  ||.:.....:|:.|||.|.|:||:...:||| .:....|.|||.||   .||.
  Fly   196 MAV-TDRYTG--YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLK---REYY 254

  Fly   214 KLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQDHH------HRYNGTWDCIKQTWRFE 272
            ::..:.|..|...|||.|.:......|:||..:||.|:|...      .||....:.:.:.:|.|
  Fly   255 EVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREE 319

  Fly   273 GYR-GFYKGLKASLTRVVPACMVTFLVYENVSHFL--LARRKRIE 314
            |.: ||||||..:..:...|..::|..|:.:..:|  ||..:|:|
  Fly   320 GVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELANLRRVE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 76/274 (28%)
Mito_carr 23..115 CDD:278578 20/94 (21%)
Mito_carr 119..213 CDD:278578 29/94 (31%)
Mito_carr 220..307 CDD:278578 28/95 (29%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 19/87 (22%)
Mito_carr 169..251 CDD:278578 28/87 (32%)
Mito_carr 279..356 CDD:278578 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.