DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and Dic1

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:291 Identity:70/291 - (24%)
Similarity:124/291 - (42%) Gaps:51/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GGVVS---TLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTPNVWG- 92
            ||:.|   .::.|||||||:......|       :..::.....:.|::|....|.|::.:|.. 
  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQG-------HLSVAQLIPKLAREQGVLVFYNGLSASVLRQ 70

  Fly    93 ---SGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQC 154
               |.:.:|:|......:.|...||...:          |..||::..::..|..:|..|  :|.
  Fly    71 LTYSTARFGVYEAGKKYVNTDSFGGKVAL----------AGASGLVGGIVGTPADMVNVR--MQN 123

  Fly   155 DA----ASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGAIQFMTYEELKNAYNEYRKL 215
            |.    .....|......|.::|::||.:.|:.|   .....:.|.:  ||..::  |:.:..|:
  Fly   124 DVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSG---ATAATARGIL--MTIGQI--AFYDQTKI 181

  Fly   216 PIDTKLAT--------TEYLAFAAVSKLIAAAATYPYQVVRAR-LQDHHHRYNGTWDCIKQTWRF 271
            .:   |||        |.:.| :.|:..||...|.|..|::.| :......:||.||.:|.|.:.
  Fly   182 YL---LATPYFQDNLVTHFTA-SLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKL 242

  Fly   272 EGYRGFYKGLKASLTRVVPACMVTFLVYENV 302
             |..||:||...:..|:.|..::||:..|.:
  Fly   243 -GPLGFFKGYVPAFVRLGPHTIITFVFLEQL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 65/274 (24%)
Mito_carr 23..115 CDD:278578 21/89 (24%)
Mito_carr 119..213 CDD:278578 19/97 (20%)
Mito_carr 220..307 CDD:278578 28/92 (30%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 20/85 (24%)
PTZ00169 13..273 CDD:240302 70/291 (24%)
Mito_carr 89..184 CDD:278578 23/116 (20%)
Mito_carr 189..278 CDD:278578 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.