DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and GC1

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:315 Identity:80/315 - (25%)
Similarity:132/315 - (41%) Gaps:46/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LVAGVSGGVVSTLILHPLDLIKIR-----FAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKG 85
            ::.|...|::....:.||||:|.|     ...|..|     .|..:...|...::.||:.|:|:|
  Fly    25 IINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGER-----MYNSMFDCFRKTYKAEGYFGMYRG 84

  Fly    86 -------VTPN--VWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTN 141
                   :||.  :..:.:.   ||....|.|      :..:||  |..|:|...:|...:::|.
  Fly    85 SGVNILLITPEKAIKLTAND---YFRHKLTTK------DGKLPL--TSQMVAGGLAGAFQIIVTT 138

  Fly   142 PIWVVKTRLCLQCDAASSAEYRG-------MIHALGQIYKEEGIRGLYRGF-VPGMLGVSHGAIQ 198
            |:.::|.::......|::|:..|       ......|:.|::||.|||:|. ..|:..|:...|.
  Fly   139 PMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIY 203

  Fly   199 FMTYEELKNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQ-----DHHHRY 258
            |..:..| |.....|.......:....:||..|... .||.|..|:.||:.|||     |....:
  Fly   204 FPLFATL-NDLGPRRNDGSGEAVFWCSFLAGLAAGS-TAALAVNPFDVVKTRLQAIKKADGEKEF 266

  Fly   259 NGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYE-NVSHFLLARRKR 312
            .|..|||.:|.:.||...|:||....:..:.|...:...||. .|:..||..:|:
  Fly   267 KGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLFGIAQTVYYLGVAEGLLGYQKK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 73/287 (25%)
Mito_carr 23..115 CDD:278578 23/102 (23%)
Mito_carr 119..213 CDD:278578 26/101 (26%)
Mito_carr 220..307 CDD:278578 27/92 (29%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 20/84 (24%)
Mito_carr 115..213 CDD:278578 26/100 (26%)
Mito_carr 226..307 CDD:278578 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.