DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and Tpc1

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:335 Identity:84/335 - (25%)
Similarity:144/335 - (42%) Gaps:47/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AQSTGS-----------PKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRF--------- 50
            |.:|||           |::.:......::.|..|:|..:..: ...|||::||||         
  Fly     2 AVTTGSTSEATTTTTPVPRRKHSTREQLHQMLAGGLSAAITRS-TCQPLDVLKIRFQLQVEPLGK 65

  Fly    51 -AVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTPN-----VWGSGSSWGLYFMFYNTIKT 109
             |..:|..|...:|..:..|..||:|:||....:||..|.     ::|....|     .|..:..
  Fly    66 NAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFW-----TYEQLSL 125

  Fly   110 FIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQCDAASSAEYRGMIHALGQIYK 174
            ..:..:.........|.|..|.:|...::::.|:.|::|||..|   .:|..||....|:..|.:
  Fly   126 MAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLIAQ---DTSKGYRNATRAVSAIVR 187

  Fly   175 EEGIRGLYRGFVPGMLGVSH-GAIQFMTYEELKNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAA 238
            :||.||:|||....:|.::. ....||.|....:....:.::...::|.|...|...|.|.:::.
  Fly   188 QEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSK 252

  Fly   239 AATYPYQVVRARLQDHHHRYN-----------GTWDCIKQTWRFEGYRGFYKGLKASLTRVVPAC 292
            ...||:.:::.|||......|           |.|||::.|.|.||.||.|||:..:|.:.....
  Fly   253 TIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTT 317

  Fly   293 MVTFLVYENV 302
            .:.|.:|:.:
  Fly   318 ALYFSIYDKL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 77/300 (26%)
Mito_carr 23..115 CDD:278578 26/106 (25%)
Mito_carr 119..213 CDD:278578 26/94 (28%)
Mito_carr 220..307 CDD:278578 27/94 (29%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 26/99 (26%)
PTZ00169 33..329 CDD:240302 79/304 (26%)
Mito_carr 153..222 CDD:278578 22/71 (31%)
Mito_carr 233..328 CDD:278578 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.