DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and Dic4

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:296 Identity:71/296 - (23%)
Similarity:123/296 - (41%) Gaps:52/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GGVVSTLI---LHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTPNVWGS 93
            ||..|..:   :.|:|::|....:.       .|.|.:......|...:|:.|.|.|.:..:...
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQ-------RQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQ 83

  Fly    94 GSSWGLYFMFYNTIKTFIQGGNTTMPLGP-TMNMLAAA---ESGILTLLLTNPIWVVKTRLCLQC 154
            .:|..::|:.|:|.|. ::..:....||. .:..:|.|   ..||.|.|:.     |:.:..::.
  Fly    84 MTSTNIHFIVYDTGKK-MEYVDRDSYLGKIILGCVAGACGSAFGIPTDLIN-----VRMQTDMKE 142

  Fly   155 DAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGAI----QFMTYEELKNAYNEYRK- 214
            .......|:.:...|.:|.||||.:.||:|   |.:.|...::    |...|:.:|   .|.|| 
  Fly   143 PPYKRRNYKHVFDGLIRIPKEEGWKALYKG---GSVAVFKSSLSTCSQIAFYDIIK---TEVRKN 201

  Fly   215 ------LPID--TKLATTEYLAFAAVSKLIAAAATYPYQVVRA-RLQDHHHRYNGTWDCIKQTWR 270
                  ||:.  |.|.|:          :|::|.|:|..|||. .:......:...:.......|
  Fly   202 ISVNDGLPLHFLTSLGTS----------IISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMR 256

  Fly   271 FEGYRGFYKGLKASLTRVVPACMVTFLVYENVS-HF 305
            | |..|.|:|...::.|..||..:.|::||.:. ||
  Fly   257 F-GVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 63/275 (23%)
Mito_carr 23..115 CDD:278578 18/85 (21%)
Mito_carr 119..213 CDD:278578 25/101 (25%)
Mito_carr 220..307 CDD:278578 23/88 (26%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 69/291 (24%)
Mito_carr 26..100 CDD:278578 18/81 (22%)
Mito_carr 104..201 CDD:278578 26/107 (24%)
Mito_carr 211..292 CDD:278578 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.