DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and CG6893

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:285 Identity:72/285 - (25%)
Similarity:123/285 - (43%) Gaps:39/285 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SGGV---VSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTPNVWG 92
            ||||   ::.....|.|||:.|..|       :.:.||::|......|..||..||.|::..:..
  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVV-------IKKDRGMASNLQQAIRTHGFISLYDGLSAQLLR 77

  Fly    93 SGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQCDAA 157
            ..:...:.|..|...|..:..     |.|....:|.||.:|.:..::..|:.::.||  :|.:.|
  Fly    78 QLTYTSMRFHLYEMGKEHLDD-----PAGLLDKVLVAALAGCVAGVVGTPMELINTR--MQVNRA 135

  Fly   158 SSAE----YRGMIHALGQIYKEEGIRGLYRG----FV-PGMLGVSHGAIQFMTYEELKNAYNEYR 213
            ...|    ||.:...|.::.:|||...||.|    |: ..::.:|..|    .|::.|..|.|:.
  Fly   136 LPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNA----AYDQAKQIYAEFF 196

  Fly   214 KLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVR-ARLQDHHHRYNGTWDCIKQTWRFEGYRGF 277
            .:..|..|.   :|..:..:..:......|.:.:| .|:.|.....|.    |....|| |.||.
  Fly   197 HMKHDNTLL---HLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINS----ISYMMRF-GSRGP 253

  Fly   278 YKGLKASLTRVVPACMVTFLVYENV 302
            ::|:...:.|:||..::|||.:|.:
  Fly   254 FRGMVPYVLRMVPNTVITFLSFEQL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 65/268 (24%)
Mito_carr 23..115 CDD:278578 22/86 (26%)
Mito_carr 119..213 CDD:278578 28/102 (27%)
Mito_carr 220..307 CDD:278578 21/84 (25%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 22/82 (27%)
Mito_carr 98..192 CDD:395101 26/104 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.