DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and SCaMC

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:312 Identity:87/312 - (27%)
Similarity:133/312 - (42%) Gaps:47/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVT 87
            :.|||||...|.||.....|||.||:...|.       .|..|:|.....:..:.|.|.:::|..
  Fly   286 WRHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ-------TQRMGISECMHIMLNEGGSRSMWRGNG 343

  Fly    88 PNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCL 152
            .||..........|..|..:|..|:|.:.:..:.......|.|.:|.::..:..|:.|:||||.|
  Fly   344 INVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLAL 408

  Fly   153 QCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGV-SHGAIQFMTYEELKNAY------N 210
            :    .:.:|.|:..|..:|||:||:|..|||:||.:||: .:..|....||.||..|      |
  Fly   409 R----RTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNN 469

  Fly   211 EYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQ---------------------DH 254
            |.....:        .||..:.|..:....:||..:||.|||                     |.
  Fly   470 EQPSFLV--------LLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDA 526

  Fly   255 HHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFL 306
            |..........::..|.||..|.|:|:..:..:|:||..::::|||..|..|
  Fly   527 HSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRAL 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 79/291 (27%)
Mito_carr 23..115 CDD:278578 27/91 (30%)
Mito_carr 119..213 CDD:278578 34/100 (34%)
Mito_carr 220..307 CDD:278578 26/108 (24%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 26/90 (29%)
Mito_carr 375..463 CDD:278578 31/91 (34%)
Mito_carr 470..581 CDD:278578 27/117 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.