DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and Shawn

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:360 Identity:87/360 - (24%)
Similarity:139/360 - (38%) Gaps:83/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NPIKAQSTGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAV-------------- 52
            ||.||..| .|:    |.....:.:.:..:|.:|:...:.|||:||.|...              
  Fly    24 NPSKATMT-DPR----FRIRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYC 83

  Fly    53 ---------------NDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFM 102
                           |.......|::.|...||..|.|.||...|:.|::|.:..:..|..:||:
  Fly    84 NGLMDHICPCGPDTPNPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFV 148

  Fly   103 FYNTIK---TFIQGGNTTMP-------------LGPTMNMLAAAESGILTLLLTNPIWVVKTRLC 151
            .|...|   |.|....|..|             |.|   :||.....||.:...:|:.:::|:  
  Fly   149 AYEQFKARFTDIHYKYTRRPDTIAHDIPHPIPFLVP---LLAGVSGRILAVTCVSPVELIRTK-- 208

  Fly   152 LQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGML-GVSHGAIQFMTYEELKNAYNEYRKL 215
            :|....:.||..|.|.   |:.:.:|:.||:||..|.:| .|....|.:..||.||:::.     
  Fly   209 MQSQRMTHAEMFGTIR---QVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSFG----- 265

  Fly   216 PIDTKLATTEYLAFA--AVSKLIAAAATYPYQVVRARLQ----------DHHHRYNGTWDC---I 265
                .:..|...:||  |:|..:||..|.|:.||:...|          |:..:...|...   :
  Fly   266 ----VVEPTFSFSFAAGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRL 326

  Fly   266 KQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYE 300
            ...:|..|....:.||...|.:|.|||.:....:|
  Fly   327 ASIYRMGGVPAIFSGLGPRLFKVAPACAIMISSFE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 76/334 (23%)
Mito_carr 23..115 CDD:278578 27/123 (22%)
Mito_carr 119..213 CDD:278578 28/107 (26%)
Mito_carr 220..307 CDD:278578 24/96 (25%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/119 (21%)
Mito_carr 178..265 CDD:278578 27/94 (29%)
Mito_carr 268..371 CDD:278578 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.