DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and sea

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:286 Identity:76/286 - (26%)
Similarity:138/286 - (48%) Gaps:26/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTPNV 90
            :..|::|| :...|.:|.:.:|.:..:::...|  .:|.|:.........:.||.|||:|::..|
  Fly    38 VAGGITGG-IEICITYPTEYVKTQLQLDEKGAA--KKYNGIFDCVKKTVGERGFLGLYRGLSVLV 99

  Fly    91 WG----SGSSWGLY-FMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGIL-TLLLTNPIWVVKTR 149
            :|    |.:.:|.: |:..|.:.:..|..|:.       .:|....:|:. .::...|:..:|.:
  Fly   100 YGSIPKSAARFGAFEFLKSNAVDSRGQLSNSG-------KLLCGLGAGVCEAIVAVTPMETIKVK 157

  Fly   150 LCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGV-SHGAIQFMTYEELKNAY--NE 211
            . :....:.:.::||..|.:|||.|.|||.|:|:|..|.:|.. |:.||:|...|.||:.|  ::
  Fly   158 F-INDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDD 221

  Fly   212 YRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQD-HHHRYNGTWDCIKQTWRFEGYR 275
            :.| |: .||...   .|.|::...:.....|..||:.|:|. ...:|..|..|..:..:.||..
  Fly   222 HTK-PV-PKLVVG---VFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPA 281

  Fly   276 GFYKGLKASLTRVVPACMVTFLVYEN 301
            .||||....|.||.....:||::|::
  Fly   282 AFYKGTVPRLGRVCLDVAITFMIYDS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 71/270 (26%)
Mito_carr 23..115 CDD:278578 22/93 (24%)
Mito_carr 119..213 CDD:278578 27/97 (28%)
Mito_carr 220..307 CDD:278578 24/83 (29%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 73/279 (26%)
Mito_carr 34..117 CDD:278578 20/81 (25%)
Mito_carr 125..220 CDD:278578 29/102 (28%)
Mito_carr 235..314 CDD:278578 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.