DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and CG9582

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:316 Identity:81/316 - (25%)
Similarity:131/316 - (41%) Gaps:39/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 STGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGR------TATVPQYRGL 66
            :|.|.:.....||  ::.|..|:| |.:..:..||||::|.|..:....      ..|.|     
  Fly     2 ATRSEETVRSLAH--WQFLAGGLS-GFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCP----- 58

  Fly    67 SSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAE 131
            ..|...|:|.||...|:||:.|.:.......|..|:.|.::|.:.|.| ...|. |..:.::.:.
  Fly    59 LDAIVKIYRYEGLSSLWKGIVPPICVETPKRGGKFLMYESLKPYFQFG-APQPT-PLTHAMSGSM 121

  Fly   132 SGILTLLLTNPIWVVKTRLCLQCDAASSAEYRG----MIHALGQIYKEE--GIRGLYRGFVPGML 190
            :.||...|.||..|||         .:...:||    .:..:..|.|.:  ||:|||||..   .
  Fly   122 AAILESFLVNPFEVVK---------ITQQAHRGKRLKTLSVVKYIIKHDGYGIKGLYRGIT---A 174

  Fly   191 GVSHGAIQFMTYEELKNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQDHH 255
            .|:..|:....:....||..:....|.|........:..|.::..:|...:....:.:.|:|...
  Fly   175 LVARNAVFHFGFFGFYNALKDIVPSPEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQ 239

  Fly   256 H-----RYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFL 306
            .     :|..|...||.|::.||:|..:|||.|.:.||.|...:..:.||.:..||
  Fly   240 PVKGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 72/290 (25%)
Mito_carr 23..115 CDD:278578 26/97 (27%)
Mito_carr 119..213 CDD:278578 25/99 (25%)
Mito_carr 220..307 CDD:278578 23/92 (25%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 77/299 (26%)
Mito_carr 17..104 CDD:278578 25/92 (27%)
Mito_carr 109..196 CDD:278578 25/99 (25%)
Mito_carr 216..295 CDD:278578 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.