DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and MME1

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:313 Identity:80/313 - (25%)
Similarity:133/313 - (42%) Gaps:32/313 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NPIKAQSTGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRF-AVNDGRTATVPQYRG 65
            ||:|:                   .:||..||:.:.|:.||||.||:|. .:........|:|:|
  Fly    13 NPVKS-------------------FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKG 58

  Fly    66 LSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAA 130
            :.......||.|||||.|:|::..:.|....:.:.|..|...|...|..:......|.: ..|.|
  Fly    59 VIDCAARTFRYEGFRGFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQI-FAAGA 122

  Fly   131 ESGILTLLLTNPIWVVKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHG 195
            .:|:.:.|:|.|...:|..|..|..:.....|.|.|....::|::.|||.|::|....:|..|..
  Fly   123 LAGVCSALVTVPTDRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT 187

  Fly   196 AIQFMTYEELKNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQD-----HH 255
            ...|:|||.|:..   .||...:.|::||..:.....:.::......|:.|:::|||.     :.
  Fly   188 GFYFVTYEFLQEL---ARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYK 249

  Fly   256 HRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFLLA 308
            |   |.....:.....||.:..::|:...|.|..|:....|...|..:..|.|
  Fly   250 H---GIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLLKA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 71/279 (25%)
Mito_carr 23..115 CDD:278578 29/92 (32%)
Mito_carr 119..213 CDD:278578 26/93 (28%)
Mito_carr 220..307 CDD:278578 18/91 (20%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 32/112 (29%)
Mito_carr 111..205 CDD:278578 28/97 (29%)
Mito_carr 208..297 CDD:278578 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.