DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and colt

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:322 Identity:84/322 - (26%)
Similarity:129/322 - (40%) Gaps:55/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NPIKAQSTGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQ---- 62
            ||:|:..||.                   .||:.:.|..||||.||:|.       .|:|:    
  Fly    14 NPVKSFLTGG-------------------FGGICNVLSGHPLDTIKVRL-------QTMPRPAPG 52

  Fly    63 ----YRGLSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPT 123
                |||.........:.||.||||||::..:.|....:.:.|..|...|...|.|.......|.
  Fly    53 EQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQ 117

  Fly   124 MNMLAAAESGILTLLLTNPIWVVKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPG 188
            : .:|.:.||:.:.|:..|...:|..|..|.......:|.|||...|::|||.|:|.:::|....
  Fly   118 I-FVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCAT 181

  Fly   189 ML-GVSHGAIQFMTYEELKNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATY----PYQVVR 248
            || .:....:.|:.||.|:    :..|...:|...:|....||..   :|..|.:    |..|::
  Fly   182 MLRDLPANGLYFLVYEALQ----DVAKSKSETGQISTASTIFAGG---VAGMAYWILGMPADVLK 239

  Fly   249 ARLQD-----HHHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHF 305
            :|||.     :.|   |.....|.....:|....|:|:...:.|..||....|...|..:.|
  Fly   240 SRLQSAPEGTYKH---GIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 73/291 (25%)
Mito_carr 23..115 CDD:278578 28/99 (28%)
Mito_carr 119..213 CDD:278578 26/94 (28%)
Mito_carr 220..307 CDD:278578 22/95 (23%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 32/118 (27%)
Mito_carr 112..202 CDD:395101 26/94 (28%)
Mito_carr 210..299 CDD:395101 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.