DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and Rim2

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:364 Identity:105/364 - (28%)
Similarity:161/364 - (44%) Gaps:84/364 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HLVAGVSGGVVSTLILHPLDLIKI------------RFAVNDG---------------------- 55
            ||:||.|.|.|..::..||:::|.            |.|.|.|                      
  Fly    11 HLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLST 75

  Fly    56 ---RTATVPQ------------YRGLSSAFTT------------IFRQEGFRGLYKGVTPNVWGS 93
               |..:.||            :.|:||  ||            |.:.||.|.|:||:.||:.|.
  Fly    76 TILRNRSQPQVIGGVRRIMAISHCGISS--TTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGV 138

  Fly    94 GSSWGLYFMFYNTIKTFIQGGNTTMPLG------PTMNMLAAAESGILTLLLTNPIWVVKTRLCL 152
            ..|..:||..|:..|      ||...||      |.:::::||.:|.::...|||||.||||:.|
  Fly   139 APSRAIYFCTYSQTK------NTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQL 197

  Fly   153 QCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGAIQFMTYEELKNAYNEYR-KLP 216
            ..::......|..|.   ::|.:.|:...|:|......|:....:.|:.||.:|:...|.| :..
  Fly   198 DYNSKVQMTVRQCIE---RVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQRH 259

  Fly   217 IDTKLATTEYLAF---AAVSKLIAAAATYPYQVVRARLQDHHHRYNGTWDCIKQTWRFEGYRGFY 278
            .||| .:.::|.|   .||||.||:...||::|.|.||::..::||..|..:...|:.||..|.|
  Fly   260 TDTK-GSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEGRAGLY 323

  Fly   279 KGLKASLTRVVPACMVTFLVYENVSHFLLARRKRIETKE 317
            :||...|.|.:|...:....||.|. ::|.||...::.|
  Fly   324 RGLATQLVRQIPNTAIMMATYEAVV-YVLTRRFNNKSNE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 96/332 (29%)
Mito_carr 23..115 CDD:278578 37/150 (25%)
Mito_carr 119..213 CDD:278578 28/99 (28%)
Mito_carr 220..307 CDD:278578 31/89 (35%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 38/152 (25%)
Mito_carr 163..253 CDD:278578 25/92 (27%)
Mito_carr 268..355 CDD:278578 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.