DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and CG1628

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:308 Identity:78/308 - (25%)
Similarity:127/308 - (41%) Gaps:50/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQ-YRGLSSAFTTIFRQEG-FRGLYKGVTPN 89
            :||..||.....:..|||.:|::.       .|.|: |||:...|.:.:|::| .||||.|..|.
  Fly   174 LAGSLGGAAQVYVSQPLDTVKVKL-------QTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPA 231

  Fly    90 VWGSGSSWGLYFMFYNTIKTFIQ---GGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRL- 150
            |:.:.:...:.|..|...:.|:.   |..|...|....|..|.:.:...:.|...|..::|.:| 
  Fly   232 VFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQ 296

  Fly   151 CLQ-----CDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGAIQFMTYEELKNAYN 210
            .|:     .:.|...:.|........|::.|||||.|||.....|....|...|.      .:|.
  Fly   297 ALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFF------GSYE 355

  Fly   211 EYRKL------------PIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQD---HHHRYNG 260
            ..|:|            |:.|.:|       .|:..:....:|:|..|:::|:|.   :...:..
  Fly   356 GTRELLRRDDQSKDDIGPLRTMIA-------GAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAV 413

  Fly   261 TWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFLLA 308
            ..|.:::    ||....|:||..|:.|.:||....|:|||.....|.|
  Fly   414 GADIVRR----EGVLALYRGLLPSVLRTIPATATLFVVYEYTKRALSA 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 69/285 (24%)
Mito_carr 23..115 CDD:278578 27/92 (29%)
Mito_carr 119..213 CDD:278578 23/99 (23%)
Mito_carr 220..307 CDD:278578 21/89 (24%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 76/304 (25%)
Mito_carr 170..252 CDD:278578 25/84 (30%)
Mito_carr 263..364 CDD:278578 25/106 (24%)
Mito_carr 369..455 CDD:278578 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441770
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.