DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8026 and SPAC688.09

DIOPT Version :9

Sequence 1:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_594067.1 Gene:SPAC688.09 / 2543465 PomBaseID:SPAC688.09 Length:361 Species:Schizosaccharomyces pombe


Alignment Length:310 Identity:95/310 - (30%)
Similarity:148/310 - (47%) Gaps:28/310 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFR-------------- 75
            |.:||...|::..:...|||::|.|...:..:...:.|.....|..|..:|              
pombe    51 HFIAGGVAGMLGAIATAPLDVVKTRLQSDFYKDRFLKQTAKSKSPLTAAYRHFMDTCIILKNVKV 115

  Fly    76 QEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLT 140
            .||.|.|::|:.||:.|:..:..:.|..|...|..:............::::|||.:|::|...|
pombe   116 HEGTRALFRGLGPNLIGTIPARSINFFSYGNGKRILADLFNNGQENSQIHLMAAAIAGVITSAAT 180

  Fly   141 NPIWVVKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGAIQFMTYEEL 205
            ||||:|||||.|...:..:|:||..|..:.:..:.||.||||:|....:|||....:|::.||:.
pombe   181 NPIWLVKTRLQLDKKSGQAAQYRSSIDCIIKTIRLEGFRGLYKGLSASLLGVGESTLQWVLYEKF 245

  Fly   206 KN--AYNEYRKLPI-------DTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQDHHH----- 256
            |:  |..:.|:..:       |..|.....|..|.::|.:||...||::|||.||:....     
pombe   246 KHAVAIRQLRRKELGIQETIYDKVLDWGGKLGGAGIAKFMAAGIAYPHEVVRTRLRQSPSINGTP 310

  Fly   257 RYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFL 306
            :|.|...|.|..|..:|..|.|.||.|.|.||||...:.|..||.:.||:
pombe   311 KYTGLIQCFKLVWMEQGIVGLYGGLTAHLLRVVPNACILFGSYEVIMHFI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 86/289 (30%)
Mito_carr 23..115 CDD:278578 24/103 (23%)
Mito_carr 119..213 CDD:278578 35/95 (37%)
Mito_carr 220..307 CDD:278578 34/92 (37%)
SPAC688.09NP_594067.1 Mito_carr 46..151 CDD:278578 24/99 (24%)
PTZ00169 49..349 CDD:240302 90/297 (30%)
Mito_carr 158..247 CDD:278578 33/88 (38%)
Mito_carr 268..361 CDD:278578 34/93 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I2476
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.