DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and YPT7

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_013713.1 Gene:YPT7 / 855012 SGDID:S000004460 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:69/215 - (32%)
Similarity:114/215 - (53%) Gaps:13/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 SDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIA 541
            |.:::::.|::::|:.|.||||.:.|||:..:||.|:||||.||..|.:..|.:.:..:|:||.|
Yeast     2 SSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTA 66

  Fly   542 GQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKED--LDSKVQLPDGSPIPCILLANKCD 604
            |||||.::...:|:.|....:|:|||.:.:|:.:..|:::  :.:.|..|:  ..|.::|.||.|
Yeast    67 GQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPE--TFPFVILGNKID 129

  Fly   605 QEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLADGDKFN 669
            .|:...|...:...|..:..|....|.||||..||:|.|...:....|..::      ||.:.|.
Yeast   130 AEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQ------ADTEAFE 188

  Fly   670 LSAADATG---SDAKNKCSC 686
            ....||..   ....|.|||
Yeast   189 DDYNDAINIRLDGENNSCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 66/206 (32%)
RAB 484..652 CDD:197555 58/169 (34%)
YPT7NP_013713.1 Rab7 9..182 CDD:206655 59/180 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.