DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and ARA7

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_193699.1 Gene:ARA7 / 827706 AraportID:AT4G19640 Length:200 Species:Arabidopsis thaliana


Alignment Length:159 Identity:57/159 - (35%)
Similarity:90/159 - (56%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 KILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNM 549
            |::::|::|.||:|.:.|:|...|.:...:|||..|..:.|..:..| |:.::||.|||||:.::
plant    12 KLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDAT-VKFEIWDTAGQERYHSL 75

  Fly   550 TRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLA-NKCDQEKQGIITQ 613
            ..:||:.|..|.||||||...:|:...||.::|.::     |:|...:.|| ||.|......:| 
plant    76 APMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQ-----GNPNMVMALAGNKSDLLDARKVT- 134

  Fly   614 PEKMDEYVRENGFAGWFETSAKENINIDE 642
            .|....|.:|||.. :.|||||...|:.|
plant   135 AEDAQTYAQENGLF-FMETSAKTATNVKE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 57/159 (36%)
RAB 484..652 CDD:197555 57/159 (36%)
ARA7NP_193699.1 Rab5_related 10..172 CDD:206653 57/159 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.