DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and RABA1e

DIOPT Version :10

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_193578.1 Gene:RABA1e / 827574 AraportID:AT4G18430 Length:217 Species:Arabidopsis thaliana


Alignment Length:210 Identity:69/210 - (32%)
Similarity:114/210 - (54%) Gaps:18/210 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 DKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 542
            |..::|:|:::||:.|.||::.:.|:....||...::||||:||.:.:..| ..|::.||||.||
plant     8 DDYDYLFKLVLIGDSGVGKSNLLSRFTRNEFSIESKSTIGVEFATRSVHVD-EKIIKAQLWDTAG 71

  Fly   543 QERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDL----DSKVQLPDGSPIPCILLANKC 603
            |||:..:|..||:.||||.:|:|:||..||:.|.:|.::|    |:.|.:        :|:.||.
plant    72 QERYRAITSAYYRGAVGALLVYDITRHITFENVERWLKELRDHTDANVVI--------MLVGNKA 128

  Fly   604 DQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLADGDKF 668
            |......:...|......|||.|  :.||||.:..|:::|...::.:|.   :::|....||...
plant   129 DLRHLRAVPTEEARSFSERENMF--FMETSALDATNVEQAFTHVLTQIY---RVMSRKALDGTGD 188

  Fly   669 NLSAADATGSDAKNK 683
            .:|.......|..||
plant   189 PMSLPKGQTIDIGNK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 PHA03247 <126..481 CDD:223021 1/2 (50%)
Rab32_Rab38 484..686 CDD:206692 67/204 (33%)
RABA1eNP_193578.1 Rab11_like 11..175 CDD:206660 60/174 (34%)

Return to query results.
Submit another query.