DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and rabl2b

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001072451.1 Gene:rabl2b / 779905 XenbaseID:XB-GENE-979695 Length:225 Species:Xenopus tropicalis


Alignment Length:217 Identity:62/217 - (28%)
Similarity:107/217 - (49%) Gaps:26/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 DKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQW----DANTIVRLQLW 538
            |..|:: ||:.:|:...||:..::|::...|.....:|    |||.:.::    |.||:: :..|
 Frog    17 DSAENV-KIICLGDSAVGKSKLMERFLMDGFRPQQLST----FALTLYKYSTCVDGNTVL-VDFW 75

  Fly   539 DIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 603
            |.||||||.:|...||.:|....:||||.|..|:..:.||.::|  :...|:   ||||::|||.
 Frog    76 DTAGQERFHSMHASYYHKAHACIMVFDVQRKITYKNLGKWYQEL--REYRPE---IPCIVVANKI 135

  Fly   604 DQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLADG--- 665
            |.:    |...:|...:.:::....:| .||.:..|:.:..:..: |:.::.|..|.|..|.   
 Frog   136 DAD----IRVTQKGFNFGKKHNLPFYF-VSAADGTNVVKLFKDAI-KLAVSYKQNSQDFLDEVMR 194

  Fly   666 --DKFNLSAADATGSDAKNKCS 685
              :.|.|...:|.....|...|
 Frog   195 ELENFELEKQEAEDLSEKEDLS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 60/211 (28%)
RAB 484..652 CDD:197555 51/171 (30%)
rabl2bNP_001072451.1 RabL2 22..182 CDD:133324 51/176 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.