DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab38

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_082514.4 Gene:Rab38 / 72433 MGIID:1919683 Length:211 Species:Mus musculus


Alignment Length:176 Identity:127/176 - (72%)
Similarity:148/176 - (84%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 REHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQE 544
            :|||||:||||:||.||||.|||||||.||.:||||||||||||||.||..|:||||||||||||
Mouse     6 KEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQE 70

  Fly   545 RFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQG 609
            ||||||||||:||:||||||||||..||:.|:|||.|||||:.||:|.|:..:||||||||.|..
Mouse    71 RFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNGKPVSVVLLANKCDQGKDV 135

  Fly   610 IITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILIND 655
            ::....|||::.:|:||.||||||||||||||||:|.||..||.|:
Mouse   136 LMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 124/172 (72%)
RAB 484..652 CDD:197555 121/167 (72%)
Rab38NP_082514.4 Rab32_Rab38 10..208 CDD:206692 124/172 (72%)
RAB 10..180 CDD:197555 123/169 (73%)
Effector region. /evidence=ECO:0000250 38..46 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 263 1.000 Domainoid score I1917
eggNOG 1 0.900 - - E1_KOG4423
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001263
OrthoInspector 1 1.000 - - otm43905
orthoMCL 1 0.900 - - OOG6_103102
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3110
SonicParanoid 1 1.000 - - X1523
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.700

Return to query results.
Submit another query.