DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab20

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001103005.1 Gene:Rab20 / 689377 RGDID:1593487 Length:232 Species:Rattus norvegicus


Alignment Length:200 Identity:50/200 - (25%)
Similarity:82/200 - (41%) Gaps:60/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 KILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNM 549
            ||:::|::..||||.::||:.:.|.... :|:|..|.||  ||.:   ..:.:||.||:|:|..:
  Rat     7 KIVLLGDMNVGKTSLLQRYMERRFPDTV-STVGGAFYLK--QWRS---FNISIWDTAGREQFHGL 65

  Fly   550 TRVYYKEAVGAFIVFDV----------------TRSGTFDCVSKWKEDLDSKVQL-----PDG-- 591
            ..:|.:.|....:.:||                |.:...||:.   ..:.:||.|     |:|  
  Rat    66 GSMYCRGAAAIILTYDVNNPQSLFELEDRFLGLTETANNDCLF---AIVGNKVDLTTERGPEGGE 127

  Fly   592 -------------SPIP-------CILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKE 636
                         |.:|       .:.|..|        |.:.:.:||..........||||||.
  Rat   128 KDQASGKTGSCVSSKVPKQVHPEDAMALYKK--------ILKYKMLDEREMPGAEQMCFETSAKT 184

  Fly   637 NINID 641
            ..|:|
  Rat   185 GHNVD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 49/199 (25%)
RAB 484..652 CDD:197555 49/199 (25%)
Rab20NP_001103005.1 Rab20 7..231 CDD:133326 49/199 (25%)
Ras 7..195 CDD:278499 49/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.