DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rabl2

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_030104587.1 Gene:Rabl2 / 68708 MGIID:1915958 Length:227 Species:Mus musculus


Alignment Length:222 Identity:42/222 - (18%)
Similarity:77/222 - (34%) Gaps:61/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 SAGSSTLQITISGKKVEPSPAKKS-----------GKSRPKSDTDYLTPA------AEERKPRKK 208
            |.|.|.::..:.|.:...|..::|           |.|....|::...|:      ::...|...
Mouse    17 SRGKSPIRTWVPGMQNFGSSGRRSHASWWPIKLMVGPSLHLGDSNSWGPSTTHFLLSKNGPPLFP 81

  Fly   209 TTTTTVTTRDTSSSTRTTKLLVSKKKPQSPERESPSASPSPLITTTESTRDTPPRERAPAKPSR- 272
            ....::::|:.||.|.:::    ...|..|.:......||||.....|:.....:..||...:. 
Mouse    82 FPRCSLSSREASSETLSSQ----DTDPYYPCQGQSLTVPSPLTLPPNSSHCLGGQANAPLLSAAD 142

  Fly   273 --------------------VQSASGTG-------AVRKSQSSSASSRKL--ELMQQQQQRGHRL 308
                                |.:|.||.       |:|.:.:...||:..  |::|:.:.     
Mouse   143 IQMTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKESSQDFMDEVLQELEN----- 202

  Fly   309 NARPLAELANTEPQPSGQQSLDPSTSP 335
                 .:|...|...|||:..|.:.||
Mouse   203 -----FKLEQKEEDTSGQEQSDTTKSP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692
RAB 484..652 CDD:197555
Rabl2XP_030104587.1 P-loop_NTPase <141..186 CDD:393306 6/44 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.