DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and rab5d

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001025576.1 Gene:rab5d / 594964 XenbaseID:XB-GENE-489496 Length:213 Species:Xenopus tropicalis


Alignment Length:204 Identity:61/204 - (29%)
Similarity:107/204 - (52%) Gaps:14/204 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGN 548
            :|::::|::..||:|.:.|:|...|.:....|||..|..:.:..| :|.|:.::||.|||||:.:
 Frog    20 FKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLD-DTTVKFEIWDTAGQERYHS 83

  Fly   549 MTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLA-NKCDQEKQGIIT 612
            :..:||:.|..|.:|||:|:..|||....|.::|..:     .||...|.|| ||.|..::.:: 
 Frog    84 LAPMYYRGAQAAIVVFDITKPETFDRAKAWVKELQRQ-----ASPNIVIALAGNKSDLAEKRMV- 142

  Fly   613 QPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLADGDKFNLSAADATG 677
            :.|:...|..:.|.. :.|||||..:|::|...|:..|:..:|.......|.....|:.     |
 Frog   143 EYEEAQAYAEDTGLL-FMETSAKTAMNVNELFLAIAKKMPKSDAQNPTHAARNRGVNVQ-----G 201

  Fly   678 SDAKNKCSC 686
            |:.:.:..|
 Frog   202 SEQQPRSGC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 60/202 (30%)
RAB 484..652 CDD:197555 55/168 (33%)
rab5dNP_001025576.1 Rab5_related 19..181 CDD:206653 55/168 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.