DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and rab38c

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_005161365.1 Gene:rab38c / 562524 ZFINID:ZDB-GENE-091118-91 Length:213 Species:Danio rerio


Alignment Length:180 Identity:125/180 - (69%)
Similarity:152/180 - (84%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 KREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 543
            ::|||:|:||||:||.||||.|||||||.|||:||||||||||||||.||:.|:|||||||||||
Zfish     2 QKEHLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFALKVLHWDSQTVVRLQLWDIAGQ 66

  Fly   544 ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQ 608
            ||:||||||||:|||||.||||||||.|||.|.|||:|||.||.|.:|.|:|.:|||||.||.::
Zfish    67 ERYGNMTRVYYREAVGALIVFDVTRSSTFDAVLKWKDDLDLKVSLNNGKPVPAVLLANKSDQSRE 131

  Fly   609 GIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLI 658
            |:.:|..|:|.:.:||||.||||||||||.||:.||:.||:.||.:::.|
Zfish   132 GLCSQIPKLDTFCKENGFVGWFETSAKENSNIEAAAKCLVDHILAHEENI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 122/175 (70%)
RAB 484..652 CDD:197555 119/167 (71%)
rab38cXP_005161365.1 Rab32_Rab38 7..207 CDD:206692 122/175 (70%)
RAB 7..176 CDD:197555 120/168 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 256 1.000 Domainoid score I1997
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001263
OrthoInspector 1 1.000 - - otm24755
orthoMCL 1 0.900 - - OOG6_103102
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3110
SonicParanoid 1 1.000 - - X1523
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.