DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and rabl2

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_009291694.1 Gene:rabl2 / 561568 ZFINID:ZDB-GENE-060503-464 Length:232 Species:Danio rerio


Alignment Length:230 Identity:61/230 - (26%)
Similarity:108/230 - (46%) Gaps:50/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 MPAFG--DLTMDQEMEPAIMTSTSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGV 518
            |.|.|  ||.:|:        ..||::   .||:.:|:...||:.:.......|.|      |.|
Zfish     1 MDAGGNSDLDLDK--------YDSDEQ---VKIICLGDSAVGKSKYASCVAKLFIS------IIV 48

  Fly   519 D---------------FALKVLQW----DANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVF 564
            |               :||.:.::    :..||: :..||.||||||.:|...||.::....:||
Zfish    49 DRILTECISRPQQLSTYALTLYKYTTTINGQTIL-VDFWDTAGQERFRSMHPSYYHKSHACVMVF 112

  Fly   565 DVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGW 629
            ||.|..|:..::.|.::|  :...|:   |||:::|||.|.:.:  :||  |...:.::.|...:
Zfish   113 DVQRKITYKNLTVWYKEL--REYRPE---IPCLVVANKIDADMK--VTQ--KSFNFAKKQGLPFY 168

  Fly   630 FETSAKENINIDEAARALVNKILINDKLISADLAD 664
            | .||.:..|:.:..:..: ::.::.|..|:|..|
Zfish   169 F-VSAADGTNVVKVFKDAI-QMALSYKRNSSDFMD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 53/200 (27%)
RAB 484..652 CDD:197555 49/186 (26%)
rabl2XP_009291694.1 P-loop_NTPase 20..193 CDD:304359 49/190 (26%)
RAB 20..182 CDD:197555 49/178 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.