DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab18

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:206 Identity:72/206 - (34%)
Similarity:114/206 - (55%) Gaps:19/206 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 KILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNM 549
            |:|||||.|.||:|.|:|:|...|.||:..|||:||..||:|.| ....::.|||.||.|||.::
  Fly     7 KLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVD-GIDYKVALWDTAGAERFRSL 70

  Fly   550 TRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQP 614
            |..:|::|:||.:|:|:|...:...:..|..:|||   ..|...|..|::.||.|:|:   :...
  Fly    71 TPSFYRKALGAILVYDITSRDSLVKLETWLAELDS---YSDNPNIAIIVVGNKIDEER---VVDR 129

  Fly   615 EKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL----INDKLISADLADGDKFNLSAADA 675
            |:..::.|::. |.:.|||||.:..:.:..:.:|.||:    .|:...||.|......:|.|:.:
  Fly   130 EEGRKFARKHR-ALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNGNASAGLDIASDRDLEASAS 193

  Fly   676 TGSDAKNKCSC 686
            |       |.|
  Fly   194 T-------CYC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 71/204 (35%)
RAB 484..652 CDD:197555 62/166 (37%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 62/166 (37%)
Rab18 6..165 CDD:206656 61/165 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.