DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and RabX1

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster


Alignment Length:215 Identity:64/215 - (29%)
Similarity:100/215 - (46%) Gaps:54/215 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 KILVIGELGTGKTSFIKRYV----HQFFSQNYRATIGVDFALKVLQWDANTI-----VRLQLWDI 540
            |:||:|..|.|||..:.||:    |:  .::...||.|.|      :..|.|     ::||:||.
  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHR--KESEVPTIAVSF------FTCNIILDEVKIKLQIWDT 63

  Fly   541 AGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQ 605
            |||||:..:..:||:.|..|.:|||:|:..||..:..|.::|...||    .|:...|:.||.|.
  Fly    64 AGQERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQ----DPMILTLVGNKMDM 124

  Fly   606 EKQGIITQPEKMDEYVRENGF-------AGWFETSAKENINIDE----AARALVNKILINDKLIS 659
            :.|..::         ||..|       |.:||||.:.:..:::    .|:.||.          
  Fly   125 QAQRAVS---------REEAFVFATSIGATYFETSTETDQGLEQVFISTAQGLVR---------- 170

  Fly   660 ADLAD-GDKFNLSAADATGS 678
              ||| |...:|.:..:|.|
  Fly   171 --LADEGKSPSLRSFQSTDS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 64/215 (30%)
RAB 484..652 CDD:197555 57/186 (31%)
RabX1NP_524713.1 Ras 7..166 CDD:278499 54/179 (30%)
Rab 7..166 CDD:206640 54/179 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.