DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab11

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster


Alignment Length:221 Identity:66/221 - (29%)
Similarity:124/221 - (56%) Gaps:18/221 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 MTSTSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQL 537
            |.:..|:.::|:|:::||:.|.||::.:.|:....|:...::||||:||.:.::.|..|| :.|:
  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTI-KAQI 64

  Fly   538 WDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANK 602
            ||.|||||:..:|..||:.||||.:|:|:.:..|::.|.:|..:|.....    ..|..:|:.||
  Fly    65 WDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHAD----QNIVIMLVGNK 125

  Fly   603 CD-QEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKI--LINDKLISADLAD 664
            .| :..:.:.|...|:  :...||.: :.||||.::.|::.|.:.::.:|  :::.|.| .|..:
  Fly   126 SDLRHLRSVPTDEAKL--FAERNGLS-FIETSALDSTNVETAFQNILTEIYRIVSQKQI-RDPPE 186

  Fly   665 GDKF---NLSAAD---ATGSDAKNKC 684
            ||..   |:...|   ...:|.:.:|
  Fly   187 GDVIRPSNVEPIDVKPTVTADVRKQC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 63/210 (30%)
RAB 484..652 CDD:197555 54/170 (32%)
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 54/171 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.