DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab26

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:444 Identity:114/444 - (25%)
Similarity:185/444 - (41%) Gaps:95/444 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 MQQQQQR----------GHRLNARPLAELANTEPQPSGQ------------QSLDPSTSPPAAED 340
            |::||.|          |.|   :|...:|...|..||.            |.:.|...||...|
  Fly     1 MRRQQTRYRSDSIASPSGSR---KPSISVATPTPLASGSPTRRESLVKPTWQHITPGQLPPKTLD 62

  Fly   341 ---GVSSAES---AQTIANPPPVVRFEVGSAVRSP-LSAYEAALAAAASQQPNSNEELSDS---- 394
               |::|.:|   ......|..:|.....|..:.| |..|..:.:......|.:::..|.|    
  Fly    63 KINGIASDDSDDDGYPKRRPSVIVHQRQQSISQQPLLPEYMTSASIFRDHAPQTSQSQSQSHHLP 127

  Fly   395 ----------SIRRLSFAQQQLILGDHDSIEGRRET-LHYQSVASEYSNQDSGSEDDSEEQADTT 448
                      |:|..|..:||.:|   ||..|...| :....||........|||.     |..|
  Fly   128 SGNGFMARLNSVRLASATEQQPLL---DSGGGVSATAVARPPVAPAPVAPGPGSEG-----ASAT 184

  Fly   449 EPENAKPMPAFGDLTMDQEMEPAIMTSTSDKREHLY----KILVIGELGTGKTSFI-----KRYV 504
            ..:||           .:.:...|.:|.:.:.|..:    |::::|:.|.||||.:     .|||
  Fly   185 LCKNA-----------GRALIRMISSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYV 238

  Fly   505 HQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRS 569
            ..:|    .:|:|:||..||:..| .|.|:||:||.||||||.::|..||::|....:::|||..
  Fly   239 PSYF----LSTVGIDFRNKVVVVD-GTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNK 298

  Fly   570 GTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCD---QEKQGIITQPEKMDEYVRENGFAGWFE 631
            .|:|.:..|..::....|    ..:..:|:.||.|   .|:|   .:.|..:...||:. ..:.|
  Fly   299 TTYDNIRAWLGEIREYAQ----EDVVIVLIGNKADCSGSERQ---VKREDGERLGREHN-VPFME 355

  Fly   632 TSAKENINIDEAARALVNKILINDKLISADLADGDKFNLSAADATGSDAKNKCS 685
            ||||..:|::.:..|:..::    |....:..|..|||:.......:.|::.|:
  Fly   356 TSAKTGLNVELSFTAVARQL----KSRGYEHGDDGKFNVHDFVRDNTKARSVCA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 64/214 (30%)
RAB 484..652 CDD:197555 57/179 (32%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 64/209 (31%)
RAB 214..378 CDD:197555 58/180 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.