Sequence 1: | NP_525109.1 | Gene: | Rab32 / 35940 | FlyBaseID: | FBgn0002567 | Length: | 686 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957264.1 | Gene: | rab5ab / 393945 | ZFINID: | ZDB-GENE-040122-3 | Length: | 216 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 63/204 - (30%) |
---|---|---|---|
Similarity: | 105/204 - (51%) | Gaps: | 15/204 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 484 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGN 548
Fly 549 MTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLA-NKCD-QEKQGII 611
Fly 612 TQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILIND-KLISADLADGDKFNLSAADA 675
Fly 676 TGSDAKNKC 684 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab32 | NP_525109.1 | Rab32_Rab38 | 484..686 | CDD:206692 | 63/204 (31%) |
RAB | 484..652 | CDD:197555 | 55/169 (33%) | ||
rab5ab | NP_957264.1 | Rab5_related | 21..183 | CDD:206653 | 55/169 (33%) |
Ras | 23..184 | CDD:278499 | 55/169 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1340129at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |