DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and RabX5

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:237 Identity:57/237 - (24%)
Similarity:102/237 - (43%) Gaps:60/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 KILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALK---VLQWDANTIVRLQLWDIAGQERF 546
            |::.:|:...|||:.:.|:.:..|..||:|||||||.|:   :|..:.:    |::||.||||||
  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYS----LEMWDTAGQERF 126

  Fly   547 GNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGII 611
            ..:...||:.|....:.:|:::..:.:...||   |:|.:.. :.|..|.:.|..    .|..::
  Fly   127 RCIAGAYYRNASVIVVTYDMSKKDSLESAKKW---LNSALNY-NASKRPLVFLVG----TKADLL 183

  Fly   612 TQPEKMDEYVRENGFAG---------WFETSAKENINIDE-----AARALVNKILINDKLISADL 662
            ::    :|:||....||         ::..||:....:.|     ||.|....::...:.|.   
  Fly   184 SK----EEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIK--- 241

  Fly   663 ADGDKFNLSAADATGSDAKNK------------------CSC 686
                  |.....||.:..|::                  |:|
  Fly   242 ------NKPQEQATQASVKSQTFDLRNFFGSRLSQQKSGCTC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 56/235 (24%)
RAB 484..652 CDD:197555 50/183 (27%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 50/179 (28%)
RAB 66..225 CDD:197555 47/174 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.