DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab9

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:225 Identity:53/225 - (23%)
Similarity:98/225 - (43%) Gaps:25/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 KREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 543
            ::..|.|::::|:.|.||::.:.|:|...:.:|...||||:|..|.:..|..... ||:||.|||
  Fly     8 QKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYT-LQIWDTAGQ 71

  Fly   544 ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQ 608
            |||..:...:|:.:....:.:.:....:...:..|:.:..:...: |....|.|::.||.|...|
  Fly    72 ERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDIPAQ 135

  Fly   609 GIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLAD-GDKFNLS- 671
            ......:.:.::..|...|...|||:|...|:.:|....:.:....:.:..|:|.. ||..:|: 
  Fly   136 KRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQHGDTIDLTR 200

  Fly   672 ---------------------AADATGSDA 680
                                 ..||.|.||
  Fly   201 PIRLVQRRICCTGGGGGGGGVGQDADGDDA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 52/220 (24%)
RAB 484..652 CDD:197555 42/167 (25%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 43/171 (25%)
Ras 14..177 CDD:278499 42/164 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.