DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab30

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster


Alignment Length:212 Identity:70/212 - (33%)
Similarity:113/212 - (53%) Gaps:20/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFG 547
            |:||:::|..|.|||..::|:....|.....|||||||.:|.::.:...| :||:||.||||||.
  Fly     7 LFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKI-KLQIWDTAGQERFR 70

  Fly   548 NMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIIT 612
            ::|:.||:.|....:|:|::...||||:..|..:    :|....|.:..||:.||.|::.:.|.|
  Fly    71 SITQSYYRSAHALILVYDISCQPTFDCLPDWLRE----IQEYANSKVLKILVGNKTDRDDREIPT 131

  Fly   613 QPEKMDEYVRENGFAGWFETSAKENINID----EAARALVNKILINDKLISADLA------DGDK 667
            |..  :|:.:::... :.||||||..|::    |.|..|:.:....|...||..|      :|..
  Fly   132 QIG--EEFAKQHDMY-FLETSAKEAENVERLFYEIAAELIGQARSKDGSSSAAAAAAQRQSEGSS 193

  Fly   668 FNLSAADATGSDAKNKC 684
            ..|.:..|..  |::.|
  Fly   194 IGLGSFSAKA--AQSNC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 69/211 (33%)
RAB 484..652 CDD:197555 60/171 (35%)
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 60/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.