DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab21

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:213 Identity:65/213 - (30%)
Similarity:108/213 - (50%) Gaps:16/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGN 548
            :|.:::||...||||.:.||:...|:..:.:|:...|..:.:..:.....:|.:||.||||||..
  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78

  Fly   549 MTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQ 613
            :..:||:.:.||.:|:|:|...:|..|..|..:|    :...|:.|..|::.||.|.|:|..:|.
  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVREL----RQMRGTEIALIIVGNKTDLEEQRAVTH 139

  Fly   614 PEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL--INDKLISAD---LADGDKFNLSAA 673
            .|.: :|.|..| |.:.|||||||..:.|....|...:|  ::.:...|.   |.:.|..||:.:
  Fly   140 DEAL-QYARTVG-AQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTDNLNNS 202

  Fly   674 DAT-----GSDAKNKCSC 686
            |.:     |..|..:..|
  Fly   203 DDSEAPDPGDPAGQRSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 64/211 (30%)
RAB 484..652 CDD:197555 55/167 (33%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 55/167 (33%)
Ras 15..177 CDD:278499 55/167 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.