DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab5

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:181 Identity:55/181 - (30%)
Similarity:99/181 - (54%) Gaps:9/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 TSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDI 540
            ||..:...:|::::||...||:|.:.|:|...|.:...:|||..|..:.:..: :|:|:.::||.
  Fly    22 TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIE-DTVVKFEIWDT 85

  Fly   541 AGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLA-NKCD 604
            |||||:.::..:||:.|..|.:|:|:....:|.....|.::|..:     .||...|.|| ||.|
  Fly    86 AGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQ-----ASPNIVIALAGNKAD 145

  Fly   605 QEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILIND 655
            .....:: :.::..:|..|||.. :.|||||..:|:::...|:..|:..||
  Fly   146 LSNIRVV-EFDEAKQYAEENGLL-FMETSAKTGMNVNDIFLAIAKKLPKND 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 53/173 (31%)
RAB 484..652 CDD:197555 51/168 (30%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 51/169 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.