DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab9Fb

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_727472.1 Gene:Rab9Fb / 32029 FlyBaseID:FBgn0052670 Length:214 Species:Drosophila melanogaster


Alignment Length:224 Identity:63/224 - (28%)
Similarity:116/224 - (51%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 EHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQER 545
            ::|:||||:|::|.||:..:.|:....|::.:..|:|:||.::.::. |..:|.||:||.||.||
  Fly     5 DYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVEL-AGRMVMLQIWDTAGDER 68

  Fly   546 FGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGI 610
            |.::...||:.|.|..:|:|:|.|.:|..:..|.::    ::......:..:|:.||||      
  Fly    69 FKSLLPSYYRGAHGILLVYDITSSKSFRNIDGWLKE----IRRMSSESVNVMLVGNKCD------ 123

  Fly   611 ITQPEKMDEYVR-ENGF-------AGWFETSAKENINIDEAARAL----VNKILIN--DKLI--- 658
                :..:..|| |.||       .|::|.|||...|:::....|    .|:::|:  ::|.   
  Fly   124 ----DLDNRQVRMEQGFNYANHRALGFYEVSAKSGANVNDVFNMLSVGIYNRLVIHTPNRLSGGQ 184

  Fly   659 -SADLAD--GDKFNLSAADATGSDAKNKC 684
             :.|.|:  .:..||:..|...:...|.|
  Fly   185 ETEDTAEPPDEPINLAGKDRQRAKDSNTC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 62/221 (28%)
RAB 484..652 CDD:197555 53/179 (30%)
Rab9FbNP_727472.1 RAB 8..171 CDD:197555 52/177 (29%)
Rab 8..165 CDD:206640 51/171 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.