Sequence 1: | NP_525109.1 | Gene: | Rab32 / 35940 | FlyBaseID: | FBgn0002567 | Length: | 686 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659124.2 | Gene: | Rab29 / 226422 | MGIID: | 2385107 | Length: | 204 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 102/199 - (51%) |
---|---|---|---|
Similarity: | 142/199 - (71%) | Gaps: | 3/199 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 480 REHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQE 544
Fly 545 RFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQG 609
Fly 610 IITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLA-DGDKFNLSAA 673
Fly 674 DATG 677 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab32 | NP_525109.1 | Rab32_Rab38 | 484..686 | CDD:206692 | 99/195 (51%) |
RAB | 484..652 | CDD:197555 | 92/167 (55%) | ||
Rab29 | NP_659124.2 | Rab32_Rab38 | 8..204 | CDD:206692 | 99/195 (51%) |
RAB | 8..176 | CDD:197555 | 92/169 (54%) | ||
Effector region. /evidence=ECO:0000250 | 36..44 | 4/7 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4423 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001263 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |