DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab32 and Rab29

DIOPT Version :9

Sequence 1:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_659124.2 Gene:Rab29 / 226422 MGIID:2385107 Length:204 Species:Mus musculus


Alignment Length:199 Identity:102/199 - (51%)
Similarity:142/199 - (71%) Gaps:3/199 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 REHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQE 544
            |:||:|:||:|:...||||.::||....||::|::|:|||||||||||..:.:||||||||||||
Mouse     4 RDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQE 68

  Fly   545 RFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQG 609
            ||.:|||:||::|....|:||||.:.||....:||:|||||:.||.|.|:||:|||||.|.....
Mouse    69 RFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWA 133

  Fly   610 IITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLA-DGDKFNLSAA 673
            :  ..:::|::.:||||.||.|||.|||.||:||.|.||.|::.|.:.....|: .|:..||.|.
Mouse   134 V--SRDQIDQFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDVMSLSTQGNYINLQAK 196

  Fly   674 DATG 677
            .::|
Mouse   197 PSSG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 99/195 (51%)
RAB 484..652 CDD:197555 92/167 (55%)
Rab29NP_659124.2 Rab32_Rab38 8..204 CDD:206692 99/195 (51%)
RAB 8..176 CDD:197555 92/169 (54%)
Effector region. /evidence=ECO:0000250 36..44 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4423
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001263
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.